PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G03183.1.p
Common NameEUGRSUZ_G03183, LOC104454496
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 560aa    MW: 61166.2 Da    PI: 5.8089
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G03183.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-174087148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT  Ed +lvd+vk++G g+W+++ +  g+ R++k+c++rw ++l
  Eucgr.G03183.1.p 40 KGPWTSAEDAILVDYVKKHGEGNWNAVQKFSGLSRCGKSCRLRWANHL 87
                      79******************************************9986 PP

2Myb_DNA-binding50.93.6e-1693136146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g++++eE+ l+v++++++G++ W++ a++++ gRt++++k++w++
  Eucgr.G03183.1.p  93 KGAFSAEEERLIVELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 136
                       799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3973587IPR017930Myb domain
SuperFamilySSF466892.4E-3039134IPR009057Homeodomain-like
SMARTSM007176.8E-153989IPR001005SANT/Myb domain
PfamPF002495.4E-154087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-234195IPR009057Homeodomain-like
CDDcd001672.88E-114287No hitNo description
PROSITE profilePS5129425.81388142IPR017930Myb domain
SMARTSM007171.3E-1692140IPR001005SANT/Myb domain
PfamPF002495.7E-1593136IPR001005SANT/Myb domain
CDDcd001674.93E-1295136No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2496141IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MSHATFECDD GVVSQDQIGS PLMDKGKSGG SEDGGLVLKK GPWTSAEDAI LVDYVKKHGE  60
GNWNAVQKFS GLSRCGKSCR LRWANHLRPN LKKGAFSAEE ERLIVELHAK MGNKWARMAA  120
HLPGRTDNEI KNYWNTRIKR RQRAGLPLYP AELCMQALQD GQQGQTFCRM TNGNKGHHEI  180
LQGSGYEIPD IVFDSFKANH SVLPYTPEIS DISATGLLMK GLASSQCGGL VQPTMPRHKR  240
LRQSASFYPG YGGIFKDAFP SMHQFEDDSR EKLSRAIVHP FPIDHDPDKN PLPFGVVQGS  300
HSFSNGNSST SEPSYEALKL ELPSLQYSEP DMGSWDTSSS PPTLLESVDN FILSPARTGK  360
AESECLSPRN SGLLDALVHE SKTMSSAKNN SPEKSTNSSA LTPGDISSST LDICKSEWEE  420
YGDPISPRGH SATSVFNGCT PLSTSGSSLD EQPHPDTFTA YNVKPEPFNL QSPESKHEIP  480
AHCDLMRPDA LLASDWFGLG SGSLKDQSTV SDSMVSLLGD DLCNDYKQSI GTCTSDQEWR  540
LNSCAWNNMP SACQMPELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30381415107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G03183.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010067659.10.0PREDICTED: transcription factor GAMYB
RefseqXP_010067660.10.0PREDICTED: transcription factor GAMYB
TrEMBLA0A059BHZ00.0A0A059BHZ0_EUCGR; Uncharacterized protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-123myb domain protein 33